We value your privacy

We use cookies to analyze site usage and improve your experience. You can accept all, reject non-essential, or customize. See our Privacy Policy.

Peptides shop · beta-Defensin-1, human · Reference sheet

beta-Defensin-1, human

Reference sheet · Antimicrobial · CPC catalog code DEFS-003

Identity

Name
beta-Defensin-1, human
Catalog code
DEFS-003
Category
Antimicrobial

Physicochemical properties

Sequence
H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (trifluoroacetate salt) (Cys5 and 34 bridge, Cys12 and 27 bridge, Cys17 and 35 bridge)
One-letter
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Residues
36 amino acids
Molecular formula
C167H262N48O50S6 computed from sequence
Molecular weight
3934.58 g/mol average mass, free peptide, computed
Net charge (pH 7)
+4.1 (6 basic / 1 acidic)
Hydrophobic residues
47%
Cysteine present
Yes — disulfide formation and oxidation possible

Composition figures above are derived arithmetically from the published sequence for the unmodified free peptide. Salt forms (commonly trifluoroacetate or acetate), amidation, and other modifications shift the observed mass — always reconcile against the current lot certificate of analysis.

Reconstitution reference

Volumes for a 1 mg vial of beta-Defensin-1, human at common working concentrations. Add solvent slowly down the vial wall and swirl — do not vortex or shake.

10 mg/mL
0.1 mL diluent per 1 mg
5 mg/mL
0.2 mL diluent per 1 mg
2 mg/mL
0.5 mL diluent per 1 mg
1 mg/mL
1 mL diluent per 1 mg

Handling, storage & reconstitution

Upstream storage
-20 ± 5 °C

General guidance for this class

Reference standards in the Antimicrobial class are typically shipped as lyophilized powder and stored desiccated at −20 °C protected from light. Once reconstituted in bacteriostatic water or the assay-appropriate buffer, aliquot and store at −80 °C to minimize freeze–thaw cycles. Confirm handling requirements against your institutional biosafety and radiation protocols before use.

Mechanism & research applications

beta-Defensin-1, human sits within the Antimicrobial research class (CPC reference DEFS-003). Antimicrobial peptides typically disrupt bacterial, fungal, or viral membranes through direct electrostatic and hydrophobic interactions, or by triggering intracellular targets after translocation. Assay potency is usually reported as MIC (minimum inhibitory concentration) against reference strains. Investigators typically incorporate beta-Defensin-1, human as a reference standard, tool ligand, or substrate in the assay contexts listed above. Most commonly used in broth microdilution MIC assays (CLSI M07), radial diffusion assays, and membrane-permeabilization (SYTOX / DiSC₃-5) readouts.

Studied for

  • Minimum inhibitory concentration (MIC) screens against Gram-positive and Gram-negative panels
  • Biofilm disruption and anti-biofilm surface coatings
  • Structure–activity relationship (SAR) studies for AMP analogues
  • Host-defense and innate-immunity mechanistic work

Frequently asked

What is beta-Defensin-1, human?

beta-Defensin-1, human (CPC catalog code DEFS-003) is a synthetic antimicrobial peptide (amp) reference standard in the antimicrobial category. It is provided as a lyophilized ~1 mg vial for in-vitro research use only.

What is beta-Defensin-1, human studied for?

Published and internal research programs use beta-Defensin-1, human as a reference standard in antimicrobial workflows — for example, minimum inhibitory concentration (mic) screens against gram-positive and gram-negative panels and biofilm disruption and anti-biofilm surface coatings. Human clinical evidence is not established.

Is beta-Defensin-1, human FDA-approved for human use?

No. beta-Defensin-1, human is a research-grade reference peptide and is not approved by the FDA or any national regulator for human or veterinary therapeutic use. It is offered exclusively for in-vitro laboratory research and does not ship to the United States for consumer use.

How is beta-Defensin-1, human typically used in the lab?

In a antimicrobial workflow, beta-Defensin-1, human is reconstituted in sterile buffer or DMSO (solubility-dependent) and applied in the researcher's chosen assay format. Most commonly used in broth microdilution MIC assays (CLSI M07), radial diffusion assays, and membrane-permeabilization (SYTOX / DiSC₃-5) readouts.

Sources

View full product page →Back to catalog

Related peptides in Antimicrobial

Other reference standards in the same class — commonly cross-referenced during assay design and comparator selection.

beta-Defensin-2, human
beta-Defensin-3, human
beta-Defensin-4, human
Defensin HNP-3 (human)
alpha-Defensin 6
beta-Bag Cell Factor
CD36 Peptide P (93-110)
Magainin Spacer Peptide
Research use only. The peptides referenced on this page are supplied to qualified laboratories for in-vitro or non-human research. They are not drugs, foods, cosmetics, or dietary supplements, are not for human consumption, and are not intended to diagnose, treat, cure, or prevent any disease. Physicochemical values shown here are transcribed from the cited upstream reference sheet(s); confirm with your own certificate of analysis before use.